Blog.tokopedia.com
Beragam informasi serta tips jual beli online di Tokopedia, promo terbaru, kisah inspiratif penjual online dan berita gaya hidup terkini.
Blog.tokopedia.com Domain Statistics
Blog.tokopedia.com competitors
Tokopedia - Jual Beli Online Aman Dan Nyaman
Tokopedia adalah sebuah pasar online yang memungkinkan individu maupun pengusaha kecil menengah di
| | tokopedia.net
Dress Murah >> Info Seputar Dress Murah Terkini Dan Terbaru di Indonesia...
Blog terpercaya seputar informasi dress murah atau grosir dress murah.juga menyediakan update terkini
| | dressmurah.wordpress.com
Tokopedia | The Making of Tokopedia
The making of tokopedia
| | tokopedia.wordpress.com
Informasi Berita Terkini - Selamat Datang di Blog Saya.di Sini Anda...
Selamatdatangdiblogsaya.disiniandaakanmendapatkaninformasiberitamancanegaraterkinidanterupdate
| | alexanger.over-blog.com
Blog For it | Berita Terkini Dan Terbaru di Indonesia Dan Tempat Sharing...
Berita terkini dan terbaru di indonesia dan tempat sharing para it indonesia
| | khecex4msocool.wordpress.com
Careers at | Tokopedia
At tokopedia, we believe life is too short to spend everyday just to fulfill a job description
| | jobs.tokopedia.com
Blog Tekno Terkini
| | scrapstuffz.blogspot.co.nz
Blog Berita Terkini | Just Another Wordpress.com Site
Just another wordpress.com site
| | blogterkini.wordpress.com
a Jazi Blogs
| | jazi.blogdetik.com
Pertamanya | Catatan Online Terkini Blog | Informasi Internet Online Dan...
Informasi internet online dan teknologi informasi
| | pertamanya.wordpress.com
Blog.tokopedia.com Popular Links
blog.tokopedia.com/2011/02/susy-mulia-berkilau-di-hari-spesial |
Web Safety
blog.tokopedia.com is
website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.Is Blog.tokopedia.com Legal or Not
URLs Requested to be Removed: | 0 |
---|---|
Urls removed: | 0 |
Percent: | 0% |
Summary: | Blog.tokopedia.com is a legal, because it is not contained in the list of sites - https://transparencyreport.google.com/copyright/domains/ |
Blog.tokopedia.com Visitors Localization
Traffic Estimations | |
---|---|
Traffic Rank | 182th most visited website in the World |
indonesia | 90.5 | japan | 1.8 |
singapore | 1.3 | united states | 1.3 |
great britain | 1 |
Website categories
tokopedia 444 sites | info tips 37 sites |
yang 154'104 sites |
Blog.tokopedia.com Top Keywords
This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.
Keyword | Position | Date |
---|---|---|
oleh2 khas bali | 1 | 2016-02-03 |
cara penyajian kopi | 1 | 2016-02-03 |
tokopedia.com | 1 | 2016-02-01 |
kado ulang tahun untuk pria | 1 | 2016-01-25 |
gerakan yoga | 1 | 2016-01-23 |
kado buat bayi | 1 | 2016-01-15 |
bisnis jual sprei | 1 | 2016-01-12 |
manfaat green tea untuk kulit | 1 | 2016-01-10 |
tempat belanja murah di hongkong | 1 | 2016-01-08 |
tempat belanja murah di korea | 1 | 2016-01-08 |
Blog.tokopedia.com Backlinks History
At the last check on 2018-08-17, we found 98 backlinks. The highest value is 98, the lowest value is 98, the average is 98.
Blog.tokopedia.com Anchors Cloud
Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"
- blog( 74% )
- perjalanan tokopedia( 17% )
- silakan lihat link ini( 4% )
- amanpembayaran anda baru diteruskan ke penjual setelah barang anda terima( 4% )
Blog.tokopedia.com Terms Cloud
List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"
- blog( 7% )
- perjalanan( 7% )
- tokopedia( 7% )
- silakan( 7% )
- lihat( 7% )
- link( 7% )
- amanpembayaran( 7% )
- baru( 7% )
- diteruskan( 7% )
- penjual( 7% )
- setelah( 7% )
- barang( 7% )
- terima( 7% )
Blog.tokopedia.com Websites hosted on same IP
Jual Beli Online Aman Dan Nyaman - Tokopedia
Mal online terbesar indonesia, tempat berkumpulnya toko / online shop terpercaya se indonesia. Jual beli online semakin aman dan nyaman di tokopedia
| | every-thing4u.tokopedia.com
Blog.tokopedia.com Website Load Time
Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-31, website load time was 2.62. The highest load time is 2.62, the lowest load time is 1.52, the average load time is 1.86.